PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_018754-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 309aa    MW: 34603.9 Da    PI: 5.7124
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_018754-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.9e-19118170456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      + +++ eq+++Le+ Fe+ ++++ e++ +LAk +gL+ rqV +WFqNrRa++k
  AHYPO_018754-RA 118 KKRLNIEQVKTLEKNFEEGNKLDPERKMQLAKAIGLQPRQVAIWFQNRRARWK 170
                      4568889*********************************************9 PP

2HD-ZIP_I/II106.32.3e-34116182167
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLk 67 
                      ekk+rl+ eqvk+LE++Fee +kL+perK++la+++glqprqva+WFqnrRAR+ktkqlEkdy   +
  AHYPO_018754-RA 116 EKKKRLNIEQVKTLEKNFEEGNKLDPERKMQLAKAIGLQPRQVAIWFQNRRARWKTKQLEKDYGEAR 182
                      69*************************************************************8766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.27E-20105174IPR009057Homeodomain-like
PROSITE profilePS5007116.957112172IPR001356Homeobox domain
SMARTSM003896.9E-18115176IPR001356Homeobox domain
CDDcd000867.65E-17117173No hitNo description
PfamPF000464.8E-16118170IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-20120179IPR009057Homeodomain-like
PRINTSPR000312.2E-5143152IPR000047Helix-turn-helix motif
PROSITE patternPS000270147170IPR017970Homeobox, conserved site
PRINTSPR000312.2E-5152168IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MREMAFLSQD YIMYHNNHHH HHHHHHHDFN EDHHEDPSSI SLNILSSCPS QQFQAGVPAL  60
AMMNRPISSF PEYHQYPIDH QTHDQEDENH DHGGDQDEVS DDGSQVLVVG PGGGGEKKKR  120
LNIEQVKTLE KNFEEGNKLD PERKMQLAKA IGLQPRQVAI WFQNRRARWK TKQLEKDYGE  180
AREYGGINLN NAETVSYWSN NGSEISSDIN LNTANGSPLS SNPSNKLDQF PLNPFIPNPI  240
TQLLQPPSPK PDLDLQCPKM DPQHDTFCTI YGGANGGGVG VGGGGGNAEI ENQPPPFWAW  300
PEQHQNLN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164172RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667539.11e-118PREDICTED: homeobox-leucine zipper protein HAT7-like
SwissprotQ004663e-40HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A0K9RRG41e-122A0A0K9RRG4_SPIOL; Uncharacterized protein
STRINGPOPTR_0017s11800.11e-48(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-37homeobox 3